Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit C1

Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit C1

SKU:CSB-CF350962SKY

Regular price $1,817.50 CAD
Regular price Sale price $1,817.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain N315)

Uniprot NO.:P60681

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit C1 Alternative name(s): Mnh complex subunit C1

Gene Names:Name:mnhC1 Ordered Locus Names:SA0811

Expression Region:1-113

Sequence Info:full length protein

View full details