Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate acyltransferase(crtO)

Recombinant Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate acyltransferase(crtO)

SKU:CSB-CF758913SKY

Regular price $2,072.00 CAD
Regular price Sale price $2,072.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain N315)

Uniprot NO.:Q7A3D8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GTRIPDKYFRQKYIIFKSFNFEKHGKFWNKWFYVRKWKHKILDGHQLNQNIYDQRHLMTI NTDEIEKMIIETKRAELIHWISILPVIIFNKGSRLVKYINIFYAMIANVPIIIVQRYNRP RLTQLLRILKRRGERHD

Protein Names:Recommended name: Glycosyl-4,4'-diaponeurosporenoate acyltransferase EC= 2.3.1.-

Gene Names:Name:crtO Ordered Locus Names:SA2352

Expression Region:29-165

Sequence Info:full length protein

View full details