Gene Bio Systems
Recombinant Staphylococcus aureus Antiholin-like protein LrgA(lrgA)
Recombinant Staphylococcus aureus Antiholin-like protein LrgA(lrgA)
SKU:CSB-CF836882SUL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain MW2)
Uniprot NO.:Q8NYH2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPGSVIGLVLLFVLLCTGAVKLG EVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQII MKVTSRSKGDKVTKKIKIEEAQAHD
Protein Names:Recommended name: Antiholin-like protein LrgA
Gene Names:Name:lrgA Ordered Locus Names:MW0238
Expression Region:1-145
Sequence Info:full length protein
