Skip to product information
1 of 1

Gene Bio Systems

Recombinant Spinacia oleracea Chlorophyll a-b binding protein, chloroplastic

Recombinant Spinacia oleracea Chlorophyll a-b binding protein, chloroplastic

SKU:CSB-CF319391FKI

Regular price $2,212.00 CAD
Regular price Sale price $2,212.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Spinacia oleracea (Spinach)

Uniprot NO.:P12333

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein, chloroplastic Alternative name(s): LHCII type I CAB Short name= LHCP

Gene Names:

Expression Region:36-267

Sequence Info:full length protein

View full details