Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))
Uniprot NO.:Q83470
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SLFPPKPRATSSKPITTSSPGTPGRSPLPVSGKELGPSTQSSSKLSRKQRRRRSTKRPVQ GSPSPASPPPTRT
Protein Names:Recommended name: Polyprotein P2A Cleaved into the following 5 chains: 1. N-terminal protein 2. Serine protease EC= 3. 3.4.21.- 4. VPg 5. Putative protein p10 6. Putative protein p8
Gene Names:ORF Names:ORF2A
Expression Region:500-572
Sequence Info:full length protein