Gene Bio Systems
Recombinant Sorghum bicolor CASP-like protein Sb09g008190 (Sb09g008190)
Recombinant Sorghum bicolor CASP-like protein Sb09g008190 (Sb09g008190)
SKU:CSB-CF512937FJS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sorghum bicolor (Sorghum) (Sorghum vulgare)
Uniprot NO.:C5YVA2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKLHRLISAVLRLAAAGAAAAAAIIMVTSHETTSFFGIEMEAKYSYTPSFVFFVVAFAV AFAYSLLALLARPGSTASRLLLLSDVMVGMLLTGAVAATGAISQVGKSGNEHAGWLPICA QVQAYCSHVMGALIAGFVSLLLYFLIIMYSLHAVAEPLCSCH
Protein Names:Recommended name: CASP-like protein Sb09g008190
Gene Names:Ordered Locus Names:Sb09g008190
Expression Region:1-162
Sequence Info:full length protein
