Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sorghum bicolor CASP-like protein Sb05g019440 (Sb05g019440)

Recombinant Sorghum bicolor CASP-like protein Sb05g019440 (Sb05g019440)

SKU:CSB-CF510322FJS

Regular price $2,147.60 CAD
Regular price Sale price $2,147.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sorghum bicolor (Sorghum) (Sorghum vulgare)

Uniprot NO.:C5Y376

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFGSDDSGCHVMDDDVAPPANGSKAVTLLLRLITLALALTSAVLMATASECTIYGLDGAT ATTVTFKDYQPFIYLVGSNIAATILEVAAIYVQVGKGDDVEDAPMIPRVVLVVVDVAVQM LLYSATGAVFAAVMAYGPQISACTGAAGHFCEQVQRSKIISLAASLSAVLAAVAKDVALP CSVWPHPSS

Protein Names:Recommended name: CASP-like protein Sb05g019440

Gene Names:Ordered Locus Names:Sb05g019440

Expression Region:1-189

Sequence Info:full length protein

View full details