Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sorangium cellulosum Cobalt transport protein CbiM(cbiM)

Recombinant Sorangium cellulosum Cobalt transport protein CbiM(cbiM)

SKU:CSB-CF434465SUD

Regular price $2,200.80 CAD
Regular price Sale price $2,200.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))

Uniprot NO.:A9GQ89

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLAEGVLPLGWCAFWNALALPFVAIALHLLRRRTEQDAFYKPFVGLIAAAVFAISCMPV PVPTAGTCSHPCGTGLAAVLIGPWMTVLVTVVALLIQALFLAHGGLTTLGADVASMGIAG AFTGYFAFHLARRSGANLWVAGFLAGVTSDWATYATTALALALGLSGEGSVTSMFTGVAL AFVPTQLPLGLLEGVMTAGALAFLRARRPDILDRLQVVRLAPGAS

Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM

Gene Names:Name:cbiM Ordered Locus Names:sce0249

Expression Region:1-225

Sequence Info:full length protein

View full details