Skip to product information
1 of 1

Gene Bio Systems

Recombinant Solibacter usitatus Potassium-transporting ATPase C chain(kdpC)

Recombinant Solibacter usitatus Potassium-transporting ATPase C chain(kdpC)

SKU:CSB-CF311643SIU

Regular price $2,154.60 CAD
Regular price Sale price $2,154.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Solibacter usitatus (strain Ellin6076)

Uniprot NO.:Q02CX5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKHLLIALRVTLVFTLITGAAYPLIVTGLAKGLFRHQADGSLIQAGGHTVGSEWIGQNFT KPGYFHGRPSAAGNDGYDGLSSGGSNLGPTNQKLADRTAADIRKFRAENPTFTGSVPPDA VTASGSGLDPHISPETAEAQVARVAGARGMSQEAVRQLVAANTAGRQFGFLGEARVNVLQ LNLALDQAAPGRR

Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain

Gene Names:Name:kdpC Ordered Locus Names:Acid_0075

Expression Region:1-193

Sequence Info:full length protein

View full details