Gene Bio Systems
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 6A, chloroplastic(CAB6A)
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 6A, chloroplastic(CAB6A)
SKU:CSB-CF319393SZY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Uniprot NO.:P12360
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SADWMPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVP EALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKDSEK KKYPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATH LADPWHNNIGDVIIPKGIFPN
Protein Names:Recommended name: Chlorophyll a-b binding protein 6A, chloroplastic Alternative name(s): LHCI type I CAB-6A Light-harvesting complex I 26 kDa protein
Gene Names:Name:CAB6A
Expression Region:46-246
Sequence Info:full length protein
