Skip to product information
1 of 1

Gene Bio Systems

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic(CAB1A)

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic(CAB1A)

SKU:CSB-CF320350SZY

Regular price $2,210.60 CAD
Regular price Sale price $2,210.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Uniprot NO.:P14274

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKAVAKSAPSSSPWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVHA QSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 1A, chloroplastic Alternative name(s): LHCII type I CAB-1A Short name= LHCP

Gene Names:Name:CAB1A

Expression Region:35-265

Sequence Info:full length protein

View full details