Skip to product information
1 of 1

Gene Bio Systems

Recombinant Skeletonema costatum Probable protein-export membrane protein secG(secG)

Recombinant Skeletonema costatum Probable protein-export membrane protein secG(secG)

SKU:CSB-CF529756SZR

Regular price $1,971.20 CAD
Regular price Sale price $1,971.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Skeletonema costatum (Marine centric diatom)

Uniprot NO.:O96799

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKIIWVILSIVLIGLIFLRTPQNQGLASFSTKSNLLGSPSSAEQFLNNLTIILMIGYFS FAVFLNFSI

Protein Names:Recommended name: Probable protein-export membrane protein secG

Gene Names:Name:secG Synonyms:ycf47

Expression Region:1-69

Sequence Info:full length protein

View full details