Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sinorhizobium medicae Probable intracellular septation protein A (Smed_3090)

Recombinant Sinorhizobium medicae Probable intracellular septation protein A (Smed_3090)

SKU:CSB-CF413468STV

Regular price $2,179.80 CAD
Regular price Sale price $2,179.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sinorhizobium medicae (strain WSM419) (Ensifer medicae)

Uniprot NO.:A6UE36

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTVEAAKPKTEVSPLLKLVLELGPLMVFFFANSRGEWLASRFPVLADLGGPIFIATGLF MAATAAALAVSWMMTRTLPMMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGAIL LGGLLFGKSLLGYVFHAAFKLDEEGWRKLTVRWGVFFLFLAVLNEVIWRSFSTDFWVAFK VWGTMPITILFTLAQMPLIMKHSVDQENAK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Smed_3090

Expression Region:1-210

Sequence Info:full length protein

View full details