Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shigella dysenteriae serotype 1 UPF0060 membrane protein YnfA(ynfA)

Recombinant Shigella dysenteriae serotype 1 UPF0060 membrane protein YnfA(ynfA)

SKU:CSB-CF655526SGF

Regular price $2,028.60 CAD
Regular price Sale price $2,028.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella dysenteriae serotype 1 (strain Sd197)

Uniprot NO.:Q32G46

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRIY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT

Protein Names:Recommended name: UPF0060 membrane protein YnfA

Gene Names:Name:ynfA Ordered Locus Names:SDY_1577

Expression Region:1-108

Sequence Info:full length protein

View full details