Gene Bio Systems
Recombinant Shigella dysenteriae serotype 1 Universal stress protein B(uspB)
Recombinant Shigella dysenteriae serotype 1 Universal stress protein B(uspB)
SKU:CSB-CF657572SGF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella dysenteriae serotype 1 (strain Sd197)
Uniprot NO.:Q32AW3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Protein Names:Recommended name: Universal stress protein B
Gene Names:Name:uspB Ordered Locus Names:SDY_3568
Expression Region:1-111
Sequence Info:full length protein
