Gene Bio Systems
Recombinant Shewanella frigidimarina UPF0114 protein Sfri_3655(Sfri_3655)
Recombinant Shewanella frigidimarina UPF0114 protein Sfri_3655(Sfri_3655)
SKU:CSB-CF600433SYT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shewanella frigidimarina (strain NCIMB 400)
Uniprot NO.:Q07WY2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKVFERLMYASRWIMAPIYLGLSLILFALGIKFFQEIFHIIPNIFSIKEVDLVLITLSL IDITLVGGLLIMVMFSGYENFVSQLDVGENSEKLNWLGKMDAGSLKNKVAASIVAISSIH LLKVFMNAENIANDKIMWYLLIHITFVLSAFAMGYLDKITRK
Protein Names:Recommended name: UPF0114 protein Sfri_3655
Gene Names:Ordered Locus Names:Sfri_3655
Expression Region:1-162
Sequence Info:full length protein
