Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella denitrificans Disulfide bond formation protein B(dsbB)

Recombinant Shewanella denitrificans Disulfide bond formation protein B(dsbB)

SKU:CSB-CF621585SAAQ

Regular price $2,128.00 CAD
Regular price Sale price $2,128.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

Uniprot NO.:Q12NQ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKLVTFSQQRSAWLILMFSALGLEASALYFQYVMLLDPCVMCIYIRVAVLGLILAGLVG SIAPRFWIVRFLGMSLWGVSSAWGAKLSFELYQMQANPSPFSTCSFYPEFPTWMPLDAWM PSIFMPTGMCSDIPWTMMSLSMTQWTLIAFVGYSIAFLLFIYPGLLYKKPTNPYS

Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase

Gene Names:Name:dsbB Ordered Locus Names:Sden_1633

Expression Region:1-175

Sequence Info:full length protein

View full details