Gene Bio Systems
Recombinant Shewanella baltica UPF0114 protein Sbal_0780 (Sbal_0780)
Recombinant Shewanella baltica UPF0114 protein Sbal_0780 (Sbal_0780)
SKU:CSB-CF386275STL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shewanella baltica (strain OS155 / ATCC BAA-1091)
Uniprot NO.:A3D0P2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKVFERLMYASRWIMAPIYLGLSLILFALGVKFFQEIFHLLPNIFKIGEVDLVLLTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDNDKLSWLGKMDAGSLKNKVAASIVAISSIH LLKVFMNAENISNDKIMWYLLIHITFVLSAFAMGYLDKITRTGK
Protein Names:Recommended name: UPF0114 protein Sbal_0780
Gene Names:Ordered Locus Names:Sbal_0780
Expression Region:1-164
Sequence Info:full length protein
