
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P07217
Gene Names: GHRH
Organism: Ovis aries (Sheep)
AA Sequence: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
Expression Region: 1-44aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 32.1 kDa
Alternative Name(s): Growth hormone-releasing factor ;GRFGrowth hormone-releasing hormone ;GHRH
Relevance: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Reference: Growth hormone-releasing factor from ovine and caprine hypothalamus isolation, sequence analysis and total synthesis.Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.Biochem. Biophys. Res. Commun. 125:606-614(1984)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.