Recombinant Sheep Protransforming growth factor alpha(TGFA),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Sheep Protransforming growth factor alpha(TGFA),partial

CSB-YP023445SH
Regular price
$1,169.57 CAD
Sale price
$1,169.57 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P98135

Gene Names: TGFA

Organism: Ovis aries (Sheep)

AA Sequence: ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Expression Region: 24-97aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal GST-tagged

MW: 34.9 kDa

Alternative Name(s): EGF-like TGF Short name: ETGF TGF type 1

Relevance: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar

Reference: "Growth factor expression in skin during wool follicle development."Sutton R., Ward W.G., Raphael K.A., Cam G.R.Comp. Biochem. Physiol. 110B:697-705(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share