Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ovis aries (Sheep)
Uniprot NO.:Q28597
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ISGPWSDFFRALGAVILYLMTSIVVLVERGNNSKGAAGVLGLCAAGLFGYDAYITFPSGT RRHTAAPTDPADGPVR
Protein Names:Recommended name: Proteolipid protein 2 Alternative name(s): Differentiation-dependent protein A4 Intestinal membrane A4 protein
Gene Names:Name:PLP2 Synonyms:A4
Expression Region:1-76
Sequence Info:full length protein