Skip to product information
1 of 1

Gene Bio Systems

Recombinant Serratia proteamaculans UPF0059 membrane protein Spro_2817 (Spro_2817)

Recombinant Serratia proteamaculans UPF0059 membrane protein Spro_2817 (Spro_2817)

SKU:CSB-CF421558STJ

Regular price $2,147.60 CAD
Regular price Sale price $2,147.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Serratia proteamaculans (strain 568)

Uniprot NO.:A8GFM8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSATLILAFGMSMDAFAASIGKGASLHQPRFREALRTGLIFGVVEAITPIIGWGIGLF ASQYIMEWDHWVAFSLLFILGMRMIVEGVRNRPDEVEKVKRHGFWLLVATAIATSLDAMA IGVGLAFLQVNIVHTAMAIGCATMIMATLGMMIGRFIGPLLGKRAEILGGVVLIGIGVNI LLEHLGYLA

Protein Names:Recommended name: UPF0059 membrane protein Spro_2817

Gene Names:Ordered Locus Names:Spro_2817

Expression Region:1-189

Sequence Info:full length protein

View full details