Skip to product information
1 of 1

Gene Bio Systems

Recombinant Serratia proteamaculans Protein psiE homolog(psiE)

Recombinant Serratia proteamaculans Protein psiE homolog(psiE)

SKU:CSB-CF420550STJ

Regular price $2,067.80 CAD
Regular price Sale price $2,067.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Serratia proteamaculans (strain 568)

Uniprot NO.:A8GKC9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKTSRSVMIAKGLQRVLNVGLLLLAAILIVFLVKETIHLAKVLFVNNEESTSYLLIEGI VIYFLYFEFIALIVKYFESGYHFPLRYFIYIGITAIIRLIIVDHENPIDTLIYSAAILLL VVTLYLANTDRLKRE

Protein Names:Recommended name: Protein psiE homolog

Gene Names:Name:psiE Ordered Locus Names:Spro_4475

Expression Region:1-135

Sequence Info:full length protein

View full details