Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe V-type proton ATPase 16 kDa proteolipid subunit 2(vma11)

Recombinant Schizosaccharomyces pombe V-type proton ATPase 16 kDa proteolipid subunit 2(vma11)

SKU:CSB-CF892185SXV

Regular price $2,108.40 CAD
Regular price Sale price $2,108.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9URZ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSNLCPIYSSFFGFAGVCASMVFSCLGAGYGTALAGRGIAAVGAFRPEIVMKSLIPVVM SGIIGVYGLVMSVLIAGDMSPDNDYSLFSGFIHLSAGLAVGLTGVAAGYAIGVVGDRGVQ SFMRQDRIFVSMVLILIFAEVLGLYGLIVGLILQTKTSNVCY

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit 2 Short name= V-ATPase 16 kDa proteolipid subunit 2 Alternative name(s): Proteolipid protein vma11 Vacuolar proton pump 16 kDa proteolipid subunit 2

Gene Names:Name:vma11 ORF Names:SPAC732.01

Expression Region:1-162

Sequence Info:full length protein

View full details