Gene Bio Systems
Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C1672.14 (SPCC1672.14)
Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C1672.14 (SPCC1672.14)
SKU:CSB-CF520747SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:G2TRU2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEESPRVEKEREKRTIRNVKNKKKKVSTYFILIIILWFISLFQLQQCNLHAYSNYYKVIF ILILITTLDSLPYSNYNAMIHLLISSNTLPLPPCFTLRASLFPPFITPLTHWNVGFVRLC NLFLSSHFHPLFHLTNSAPGSRQISTSLSNNTQST
Protein Names:Recommended name: Uncharacterized transmembrane protein C1672.14
Gene Names:ORF Names:SPCC1672.14
Expression Region:1-155
Sequence Info:full length protein
