Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C30D10.09c (SPBC30D10.09c)

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C30D10.09c (SPBC30D10.09c)

SKU:CSB-CF522679SXV

Regular price $2,189.60 CAD
Regular price Sale price $2,189.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O14355

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQLLMLEQISLASSVVATTVLVAPVLSTIINLLTNFGQRIFIAADSSKSTSMEFLSTIIG AGYPIYKTYLLLELPSKRSQLLPKAFQLRNEEHKSIEEERRRLMAYWCVYGCVTAAESIL GRFLSWVPFYSTSKIVFWLWLLNPRTQGAAFIYASYISPFLSDHKAAINNFLEKLVQFTT RQPLVLNAWALVKSLIDKLPKGDVEAPGSDADTKKSK

Protein Names:Recommended name: Uncharacterized membrane protein C30D10.09c

Gene Names:ORF Names:SPBC30D10.09c

Expression Region:1-217

Sequence Info:full length protein

View full details