Recombinant Schizosaccharomyces pombe Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(sdh4)

SKU: CSB-CF865278SXV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9P7X0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANNVDTRSANTNSPTTTTSFSWFTNNMLQTRLGLGALRQGRLLFAVKSFSTTSVAKIFP PPPQTIKGTVNDAAVFPHHSKLHGS

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate-ubiquinone reductase membrane anchor subunit

Gene Names:Name:sdh4 ORF Names:SPBP23A10.16

Expression Region:1-85

Sequence Info:full length protein