Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Secretory component protein psh3(psh3)

Recombinant Schizosaccharomyces pombe Secretory component protein psh3(psh3)

SKU:CSB-CF896973SXV

Regular price $2,186.80 CAD
Regular price Sale price $2,186.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9Y876

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKRSIFRFADEKGLKVAARYGVLMSTSFIFALLFHSSVADVNTLWSPGPESAFDAAETY YTLVAGSHFIVKYTVYTIMGLNMIFHLIQATGAKGDDKLFFYSSTLLYLTALILFIVNVA PSMLVVKLQNYVQFPRNMHLSVLAASHVLVEFLLAGVILIQLGYVFGYHVQSIQQREYAE DMREQELAEKAKLESESATTQSVETVSTESVSKRK

Protein Names:Recommended name: Secretory component protein psh3

Gene Names:Name:psh3 ORF Names:SPBC409.20c

Expression Region:1-215

Sequence Info:full length protein

View full details