Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Ribonuclease MRP protein subunit rmp1(SPAC323.08)

Recombinant Schizosaccharomyces pombe Ribonuclease MRP protein subunit rmp1(SPAC323.08)

SKU:CSB-CF891624SXV

Regular price $2,181.20 CAD
Regular price Sale price $2,181.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9UT91

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQELQYDVVLLQKIVYRNRNQHRLSVWWRHVRMLLRRLKQSLDGNEKAKIAILEQLPKSY FYFTNLIAHGQYPALGLVLLGILARVWFVMGGIEYEAKIQSEIVFSQKEQKKLELQSQDD IDTGTVVARDELLATEPISLSINPASTSYEKLTVSSPNSFLKNQDESLFLSSSPITVSQG TKRKSKNSNSTVKKKKKRARKGRDEIDDIFG

Protein Names:Recommended name: Ribonuclease MRP protein subunit rmp1 Alternative name(s): RNA-processing protein rmp1

Gene Names:ORF Names:SPAC323.08

Expression Region:1-211

Sequence Info:full length protein

View full details