Recombinant Schizosaccharomyces pombe  Putative uncharacterized protein C1347.14c(SPBC1347.14c)

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C1347.14c(SPBC1347.14c)

CSB-CF645330SXV
Regular price
$1,463.00 CAD
Sale price
$1,463.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q2HQL6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLSNKIKHSIFQFFVFPFYYFLLIITEIGFSSCIQYSGLSAYFPIKCTLSLLSSPIRRV QVISDSLNVKGKRLLLVVTAHSRLRVNADIGGLISNIGCGKRPTILSTVNTGSNTSREGK S

Protein Names:Recommended name: Putative uncharacterized protein C1347.14c

Gene Names:ORF Names:SPBC1347.14c

Expression Region:1-121

Sequence Info:full length protein

Your list is ready to share