Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Protein transport protein got1(got1)

Recombinant Schizosaccharomyces pombe Protein transport protein got1(got1)

SKU:CSB-CF891826SXV

Regular price $2,059.40 CAD
Regular price Sale price $2,059.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9USJ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWLSDLQKIGVGTTALGFLFMIMGIFMFFDGPLLSLGNLLLVFGFFMIAGFSKSVSFFLR KDRMLGSISFFSGLLLTLFHFPIIGFFVECLGFFNLFKVFYPLIISFLRTVPYIGPYIDR LTSYQQSPV

Protein Names:Recommended name: Protein transport protein got1 Alternative name(s): Golgi transport protein 1

Gene Names:Name:got1 ORF Names:SPCC4B3.02c

Expression Region:1-129

Sequence Info:full length protein

View full details