Recombinant Schizosaccharomyces pombe Plasma membrane proteolipid 31(pmp31)

SKU: CSB-CF530425SXV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O74837

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNVTLSDFLLIVLSFFVPFIVVGIRRGFCTADFLINICLCALGIPGIIHAIYIVIKYPR TVRLDIENSPNDPLVRYTPNPEHAVSPHSGPAPPSYSSLASNGMP

Protein Names:Recommended name: Plasma membrane proteolipid 31 Alternative name(s): Meiotically up-regulated gene 75 protein

Gene Names:Name:pmp31 Synonyms:mug75 ORF Names:SPCC1183.09c

Expression Region:1-105

Sequence Info:full length protein