Gene Bio Systems
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim17(tim17)
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim17(tim17)
SKU:CSB-CF310827SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:P87130
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASADHTRDPCPYVILNDFGAAFSMGTIGGAIWHSIKGWRNSPPGEKRISAIAAAKTRAP VLGGNFGVWGGLFSTFDCAVKGVRRKEDPWNAIIAGFFTGGALAVRGGWRATRNGAIGCA CILAVFEGLGIALGRMNAEYNRPVAPVIPDAPASGSTSAAPAAV
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim17 Alternative name(s): Mitochondrial protein import protein 2
Gene Names:Name:tim17 ORF Names:SPAC3A12.16c
Expression Region:1-164
Sequence Info:full length protein
