Gene Bio Systems
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 150 protein(mug150)
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 150 protein(mug150)
SKU:CSB-CF530925SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O94546
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASLFIIMDKRFAVFASSDKPNNCSRKNMFFLKNIIVLSNYLYLLYKAWIVCTTISLCCD FPLFNFLFIAIPYFTEILYNDSSLLWFLFVSLCFITLSFQSLEI
Protein Names:Recommended name: Meiotically up-regulated gene 150 protein
Gene Names:Name:mug150 ORF Names:SPCC1322.07c
Expression Region:1-104
Sequence Info:full length protein
