Gene Bio Systems
Recombinant Schizosaccharomyces pombe Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5(ost5)
Recombinant Schizosaccharomyces pombe Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5(ost5)
SKU:CSB-CF515297SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:G2TRU0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLNELIVAALKLFFYNKEQKSDCIFFCQVQIVIQISSSMFSLVIRRIHIRKLWYITVFT INASMFSGFFNNPSLLTPNENLLFQVGLHYSFAV
Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5 Short name= Oligosaccharyl transferase subunit ost5 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase subunit zeta
Gene Names:Name:ost5 ORF Names:SPCC18.19c
Expression Region:1-94
Sequence Info:full length protein
