
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O94633
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQRIHKVILYYVSLTILYRVTYLFDLEEPWSTLRPYTPYLFILAFGSYLGITLLYNVATT NDKPEAYVDLVKDIKEAQDALRSKGMTIED
Protein Names:Recommended name: Dolichol-phosphate mannosyltransferase subunit 3 Alternative name(s): DPM synthase complex subunit 3 Dolichol-phosphate mannose synthase subunit 3 Dolichyl-phosphate beta-D-mannosyltransferase subunit 3 Mannose-P-doli
Gene Names:Name:dpm3 ORF Names:SPBC1677.02
Expression Region:1-90
Sequence Info:full length protein