Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Dolichol-phosphate mannosyltransferase subunit 3(dpm3)

Recombinant Schizosaccharomyces pombe Dolichol-phosphate mannosyltransferase subunit 3(dpm3)

SKU:CSB-CF007136SXV

Regular price $2,002.00 CAD
Regular price Sale price $2,002.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O94633

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQRIHKVILYYVSLTILYRVTYLFDLEEPWSTLRPYTPYLFILAFGSYLGITLLYNVATT NDKPEAYVDLVKDIKEAQDALRSKGMTIED

Protein Names:Recommended name: Dolichol-phosphate mannosyltransferase subunit 3 Alternative name(s): DPM synthase complex subunit 3 Dolichol-phosphate mannose synthase subunit 3 Dolichyl-phosphate beta-D-mannosyltransferase subunit 3 Mannose-P-doli

Gene Names:Name:dpm3 ORF Names:SPBC1677.02

Expression Region:1-90

Sequence Info:full length protein

View full details