Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Cytochrome oxidase assembly protein 3, mitochondrial(tam3)

Recombinant Schizosaccharomyces pombe Cytochrome oxidase assembly protein 3, mitochondrial(tam3)

SKU:CSB-CF522294SXV

Regular price $1,971.20 CAD
Regular price Sale price $1,971.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:G2TRJ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQGNQAFENARKPFRRANLITALGLGAFAFATFAYSVYRVHEDTFEDVVMTPELEKKIA EDRDLSKKN

Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial Alternative name(s): Transcripts altered in meiosis protein 3

Gene Names:Name:tam3 ORF Names:SPAC1B3.21

Expression Region:1-69

Sequence Info:full length protein

View full details