Gene Bio Systems
Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 9(qcr9)
Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 9(qcr9)
SKU:CSB-CF530391SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O74433
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASSTIYNIFFRRNSSFYATIFVSAFFAKIGFDVFTDSVWKRANAGLTWDEVKPRFLNKD EDAEDDE
Protein Names:Recommended name: Cytochrome b-c1 complex subunit 9 Alternative name(s): Complex III subunit 9 Cytochrome c1 non-heme 7.3 kDa protein Ubiquinol-cytochrome c reductase complex 7.3 kDa protein
Gene Names:Name:qcr9 ORF Names:SPCC1682.01
Expression Region:1-67
Sequence Info:full length protein
