Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 9(qcr9)

Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 9(qcr9)

SKU:CSB-CF530391SXV

Regular price $1,968.40 CAD
Regular price Sale price $1,968.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O74433

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASSTIYNIFFRRNSSFYATIFVSAFFAKIGFDVFTDSVWKRANAGLTWDEVKPRFLNKD EDAEDDE

Protein Names:Recommended name: Cytochrome b-c1 complex subunit 9 Alternative name(s): Complex III subunit 9 Cytochrome c1 non-heme 7.3 kDa protein Ubiquinol-cytochrome c reductase complex 7.3 kDa protein

Gene Names:Name:qcr9 ORF Names:SPCC1682.01

Expression Region:1-67

Sequence Info:full length protein

View full details