Gene Bio Systems
Recombinant Schizosaccharomyces pombe ATP synthase subunit K, mitochondrial(atp19)
Recombinant Schizosaccharomyces pombe ATP synthase subunit K, mitochondrial(atp19)
SKU:CSB-CF513109SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:C6Y4A3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MSVYTIAGRQFQAHQLSLAVLGSVFVGPVIYSKLFKRNKPLSAKDVPPLNAKSKEEEEFI LKYIEEHK
Protein Names:Recommended name: ATP synthase subunit K, mitochondrial
Gene Names:Name:atp19 ORF Names:SPAC25H1.10c
Expression Region:1-68
Sequence Info:full length protein
