1 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe ATP synthase subunit K, mitochondrial(atp19)

Recombinant Schizosaccharomyces pombe ATP synthase subunit K, mitochondrial(atp19)

CSB-CF513109SXV

$1,969.80 CAD
$1,969.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:C6Y4A3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MSVYTIAGRQFQAHQLSLAVLGSVFVGPVIYSKLFKRNKPLSAKDVPPLNAKSKEEEEFI LKYIEEHK

Protein Names:Recommended name: ATP synthase subunit K, mitochondrial

Gene Names:Name:atp19 ORF Names:SPAC25H1.10c

Expression Region:1-68

Sequence Info:full length protein

View full details