Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Uniprot NO.:A3LU53
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAEIPTSVIQKLVFFTGAMIIFPIFTFFVCQYLFSNNALISGGIAALMANVVLIGYVVV AFTEDTSSLADEKVETKKDI
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:VMA21 ORF Names:PICST_58812
Expression Region:1-80
Sequence Info:full length protein