Recombinant Scheffersomyces stipitis Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

SKU: CSB-CF385317SXM

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)

Uniprot NO.:A3LWK1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVIGAPKGHDRYRDPKTHQMTPALYRVRAPFFWKNTIGLAICTAIPLGVYMYTLHMLSK DEFGDIPIPPISDTELTKLKKEYEASKNQN

Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial

Gene Names:Name:COA3 ORF Names:PICST_32500

Expression Region:1-90

Sequence Info:full length protein