
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P41785
Gene Names: prgJ
Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
AA Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Expression Region: 1-101aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
MW: 26.9 kDa
Alternative Name(s):
Relevance: Required for invasion of epithelial cells.
Reference: "PhoP/PhoQ transcriptional repression of Salmonella typhimurium invasion genes: evidence for a role in protein secretion." Pegues D.A., Hantman M.J., Behlau I., Miller S.I. Mol. Microbiol. 17:169-181(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.