Recombinant Salmonella typhimurium Protein PrgJ(PrgJ)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Salmonella typhimurium Protein PrgJ(PrgJ)

CSB-EP331347SXB
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: prgJ

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Delivery time: 3-7 business days

Uniprot ID: P41785

AA Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-101aa

Protein length: Full Length

MW: 15.9 kDa

Alternative Name(s):

Relevance: Required for invasion of epithelial cells.

Reference: "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2."McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. Wilson R.K.Nature 413:852-856(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share