Gene Bio Systems
Recombinant Salmonella typhimurium Oxaloacetate decarboxylase gamma chain 3(oadG3)
Recombinant Salmonella typhimurium Oxaloacetate decarboxylase gamma chain 3(oadG3)
SKU:CSB-CF348310SXB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Uniprot NO.:P58650
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNSSVLLGEGFTLMFLGMGFVLAFLFLLIFAIRGMSAAVNRFFPEPVPVPKAAPAAAPAD DFARLKPVIAAAIHHHRRLNP
Protein Names:Recommended name: Oxaloacetate decarboxylase gamma chain 3 EC= 4.1.1.3
Gene Names:Name:oadG3 Synonyms:dcoC Ordered Locus Names:STM0766
Expression Region:1-81
Sequence Info:full length protein
