Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella typhimurium Oxaloacetate decarboxylase gamma chain 2(oadG2)

Recombinant Salmonella typhimurium Oxaloacetate decarboxylase gamma chain 2(oadG2)

SKU:CSB-CF312665SXB

Regular price $1,993.60 CAD
Regular price Sale price $1,993.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Uniprot NO.:Q03032

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNAALLLGEGFTLMFLGMGFVLAFLFLLIFAIRGMSAAVNRFFPEPAPAPKAAPAAAAP VVDDFTRLKPVIAAAIHHHHRLNA

Protein Names:Recommended name: Oxaloacetate decarboxylase gamma chain 2 EC= 4.1.1.3

Gene Names:Name:oadG2 Synonyms:oadG Ordered Locus Names:STM3353

Expression Region:1-84

Sequence Info:full length protein

View full details