Recombinant Salmonella typhi Universal stress protein A(uspA)

SKU: CSB-MP820596SWW

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-25 working days

Research Topic: Microbiology

Uniprot ID: Q8Z268

Gene Names: uspA

Organism: Salmonella typhi

AA Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Expression Region: 2-144aa

Sequence Info: Full Length

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

MW: 19.9 kDa

Alternative Name(s):

Relevance: Required for resistance to DNA-damaging agents.

Reference: "Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18."Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. Barrell B.G.Nature 413:848-852(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.