Gene Bio Systems
Recombinant Salmonella typhi Universal stress protein A(uspA)
Recombinant Salmonella typhi Universal stress protein A(uspA)
SKU:CSB-YP820596SWW
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Microbiology
Uniprot ID: Q8Z268
Gene Names: uspA
Organism: Salmonella typhi
AA Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
Expression Region: 2-144aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 17.9 kDa
Alternative Name(s):
Relevance: Required for resistance to DNA-damaging agents.
Reference: "Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18."Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
