Gene Bio Systems
Recombinant Salmonella paratyphi C Probable intracellular septation protein A(yciB)
Recombinant Salmonella paratyphi C Probable intracellular septation protein A(yciB)
SKU:CSB-CF507170SWU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Salmonella paratyphi C (strain RKS4594)
Uniprot NO.:C0Q398
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Name:yciB Ordered Locus Names:SPC_1994
Expression Region:1-179
Sequence Info:full length protein
