Gene Bio Systems
Recombinant Salmonella paratyphi B UPF0299 membrane protein yohJ(yohJ)
Recombinant Salmonella paratyphi B UPF0299 membrane protein yohJ(yohJ)
SKU:CSB-CF431374STF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Uniprot NO.:A9N6L5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKSLNIIWQYIRAFVLIYACLYAGIFLASLLPITIPGSIIGMLILFVLLALQILPAKWV NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAISTLVVFVVVSWSSHLIHG ERKVVGQKGTKK
Protein Names:Recommended name: UPF0299 membrane protein yohJ
Gene Names:Name:yohJ Ordered Locus Names:SPAB_00835
Expression Region:1-132
Sequence Info:full length protein
