Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella paratyphi A UPF0266 membrane protein yobD(yobD)

Recombinant Salmonella paratyphi A UPF0266 membrane protein yobD(yobD)

SKU:CSB-CF474777SWT

Regular price $2,093.00 CAD
Regular price Sale price $2,093.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella paratyphi A (strain AKU_12601)

Uniprot NO.:B5BHC3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTITDLVLILFIAALLVYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVHNIDDLEKIYKLLIENQ

Protein Names:Recommended name: UPF0266 membrane protein yobD

Gene Names:Name:yobD Ordered Locus Names:SSPA0970

Expression Region:1-152

Sequence Info:full length protein

View full details